July 26, 2020
Transmembrane Protein Topology Complete Genomes
Predicting transmembrane protein topology with a hidden Markov mannequin: utility to finish genomes
A technique has been devised for the electrophoretic switch of proteins from polyacrylamide gels to nitrocellulose sheets. The strategy leads to quantitative switch of ribosomal proteins from gels containing urea. For sodium dodecyl sulfate gels, the unique band sample was obtained with no lack of decision, however the switch was not quantitative.
The strategy permits detection of proteins by autoradiography and is easier than standard procedures. The immobilized proteins have been detectable by immunological procedures. All further binding capability on the nitrocellulose was blocked with extra protein; then a particular antibody was sure and, lastly, a second antibody directed towards the primary antibody
Human, mouse, rat connexin 37/40 hemi-channel Scrambled peptide (GAP26 area) |

stat-2
. The second antibody was both radioactively labeled or conjugated to fluorescein or to peroxidase. The particular protein was then detected by both autoradiography, underneath UV mild, or by the peroxidase response product, respectively. Within the latter case, as little as 100 pg of protein was clearly detectable. It’s anticipated that the process might be relevant to evaluation of all kinds of proteins with particular reactions or ligands.
Human NEP1-40 of Nogo-66 peptide Scrambled peptide management for NEP140 >95% pure |
Proof has collected that cytokines have a elementary place inside the differentiation of memory T cells. Proper right here, we observe the CD8+ T cell from preliminary activation to memory-cell expertise, indicating the checkpoints at which cytokines resolve the future of the T cell.
Members of the frequent cytokine-receptor gamma-chain (gammac)-cytokine family–in specific, interleukin-7 (IL-7) and IL-15–act at each stage of the immune response to promote proliferation and survival. On this technique, a safe and defending, long-lived memory CD8+ T-cell pool is likely to be propagated and maintained.
![]() 3-D Life Scrambled RGD Peptide |
|||
P11-3 | Cellendes | 3x 1 µmol | EUR 276 |
![]() 3-D Life Scrambled RGD Peptide |
|||
09-P-003 | Cellendes | 1 µmol | EUR 121 |
![]() Scrambled 10Panx |
|||
A2701-10 | ApexBio | 10 mg | EUR 258 |
Description: Scrambled 10Panx is the scrambled form of 10Panx (WRQAAFVDSY), a mimetic peptide of pannexin 1 that inhibits dye uptake by macrophages without affecting cellular membrane currents. |
![]() Scrambled 10Panx |
|||
A2701-25 | ApexBio | 25 mg | EUR 514 |
Description: Scrambled 10Panx is the scrambled form of 10Panx (WRQAAFVDSY), a mimetic peptide of pannexin 1 that inhibits dye uptake by macrophages without affecting cellular membrane currents. |
![]() Scrambled 10Panx |
|||
A2701-5 | ApexBio | 5 mg | EUR 166 |
Description: Scrambled 10Panx is the scrambled form of 10Panx (WRQAAFVDSY), a mimetic peptide of pannexin 1 that inhibits dye uptake by macrophages without affecting cellular membrane currents. |
![]() Human, mouse, rat connexin 37/40 hemi-channel Scrambled peptide (GAP26 domain) |
|||
Cx2602-PS-1 | Alpha Diagnostics | 1 mg | EUR 286 |
![]() Scrambled TRAP Fragment |
|||
5-01910 | CHI Scientific | 4 x 5mg | Ask for price |
![]() LL-37 (scrambled) |
|||
H-7886.0500 | Bachem | 0.5mg | EUR 283 |
Description: Sum Formula: C205H340N60O53; CAS# [1354065-56-7] net |
![]() LL-37 (scrambled) |
|||
H-7886.1000 | Bachem | 1.0mg | EUR 441 |
Description: Sum Formula: C205H340N60O53; CAS# [1354065-56-7] net |
![]() JAG - 1 (188 - 204), Jagged – 1 (188 - 204), Notch Ligand |
|||
5-01413 | CHI Scientific | 4 x 1mg | Ask for price |
![]() Amyloid b-Protein (1-42) (scrambled) |
|||
H-7406.0500 | Bachem | 0.5mg | EUR 441 |
Description: Sum Formula: C203H311N55O60S; CAS# [1678415-52-5] net |
![]() Amyloid b-Protein (1-42) (scrambled) |
|||
H-7406.1000 | Bachem | 1.0mg | EUR 589 |
Description: Sum Formula: C203H311N55O60S; CAS# [1678415-52-5] net |
![]() Amyloid b-Protein (1-40) (scrambled) |
|||
H-7408.0500 | Bachem | 0.5mg | EUR 335 |
Description: Sum Formula: C194H295N53O58S; CAS# [1678415-68-3] net |
![]() Amyloid b-Protein (1-40) (scrambled) |
|||
H-7408.1000 | Bachem | 1.0mg | EUR 606 |
Description: Sum Formula: C194H295N53O58S; CAS# [1678415-68-3] net |
![]() Scrambled sgRNA CRISPR Lentivector |
|||
K018 | ABM | 1.0 ug | EUR 154 |
![]() Human, mouse, rat connexin 32 hemi-channel-scrambled peptide |
|||
Cx3212-PS-5 | Alpha Diagnostics | 5 mg | EUR 773 |
![]() PAR-2 (1-6) amide (human) (scrambled) |
|||
H-6428.0025 | Bachem | 25.0mg | EUR 321 |
Description: Sum Formula: C28H54N8O7; CAS# [1348395-60-7] net |
![]() PAR-2 (1-6) amide (human) (scrambled) |
|||
H-6428.0100 | Bachem | 100.0mg | EUR 902 |
Description: Sum Formula: C28H54N8O7; CAS# [1348395-60-7] net |
![]() R-JAG (188 - 206) R - Jagged -1(188 - 206), Notch Ligand |
|||
5-01864 | CHI Scientific | 4 x 1mg | Ask for price |
![]() 5-FAM-LL-37 (scrambled) |
|||
H-7888.0500 | Bachem | 0.5mg | EUR 466 |
Description: Sum Formula: C226H350N60O59; CAS# [2022972-73-0] net |
![]() 5-FAM-LL-37 (scrambled) |
|||
H-7888.1000 | Bachem | 1.0mg | EUR 776 |
Description: Sum Formula: C226H350N60O59; CAS# [2022972-73-0] net |
![]() Biotinyl-eAhx-LL-37 (scrambled) |
|||
H-7896.0500 | Bachem | 0.5mg | EUR 452 |
Description: Sum Formula: C221H365N63O56S; CAS# [2022972-72-9] net |
![]() Biotinyl-eAhx-LL-37 (scrambled) |
|||
H-7896.1000 | Bachem | 1.0mg | EUR 747 |
Description: Sum Formula: C221H365N63O56S; CAS# [2022972-72-9] net |
![]() Tet-pLKO-Puro-Scrambled Plasmid |
|||
PVT14797 | Lifescience Market | 2 ug | EUR 370 |
![]() Teplow's Amyloid b-Protein (1-40) (scrambled II) |
|||
H-8278.0100 | Bachem | 0.1mg | EUR 142 |
Description: Sum Formula: C194H295N53O58S |
![]() Teplow's Amyloid b-Protein (1-40) (scrambled II) |
|||
H-8278.0500 | Bachem | 0.5mg | EUR 418 |
Description: Sum Formula: C194H295N53O58S |
![]() Teplow's Amyloid b-Protein (1-42) (scrambled II) |
|||
H-8282.0500 | Bachem | 0.5mg | EUR 418 |
Description: Sum Formula: C203H311N55O60S |
![]() Teplow's Amyloid b-Protein (1-42) (scrambled II) |
|||
H-8282.1000 | Bachem | 1.0mg | EUR 612 |
Description: Sum Formula: C203H311N55O60S |
![]() 5-FAM-Amyloid b-Protein (1-42) (scrambled) |
|||
H-7836.0100 | Bachem | 0.1mg | EUR 160 |
Description: Sum Formula: C224H321N55O66S |
![]() 5-FAM-Amyloid b-Protein (1-42) (scrambled) |
|||
H-7836.0500 | Bachem | 0.5mg | EUR 495 |
Description: Sum Formula: C224H321N55O66S |
![]() Human, mouse, rat connexin 32 hemi-channel-Scrambled peptide (GAP24 domain) |
|||
Cx2410-PS-5 | Alpha Diagnostics | 5 mg | EUR 773 |
![]() Human, mouse, rat connexin 43 hemi-channel-Scrambled peptide (GAP26 domain) |
|||
Cx2606-PS-5 | Alpha Diagnostics | 5 mg | EUR 773 |
![]() Human, mouse, rat connexin 43 and 37 scrambled peptide (GAP27 domain) |
|||
Cx2704-PS-5 | Alpha Diagnostics | 5 mg | EUR 773 |
![]() Human, mouse, rat connexin 40 hemi-channel-Scrambled peptide (GAP27 domain) |
|||
Cx2708-PS-5 | Alpha Diagnostics | 5 mg | EUR 773 |
![]() Amyloid ?-Peptide (1-42) (human) |
|||
B6057-.1 | ApexBio | 100 ug | EUR 276 |
![]() HIV-1 Tat Protein Peptide |
|||
B1433-1 | ApexBio | 1 mg | EUR 128 |
Description: HIV-1 Tat Protein Peptide |
![]() Human NEP1-40 of Nogo-66 peptide, Scrambled peptide control for NEP140, >95% pure |
|||
NEP140-115 | Alpha Diagnostics | 100 ug | EUR 286 |
![]() Human NEP1-40 of Nogo-66 peptide Scrambled peptide control for NEP140 >95% pure |
|||
NEP140-115-1000 | Alpha Diagnostics | 1000 ug | EUR 773 |
![]() Prion Protein (106-126) (human) (scrambled) |
|||
H-4882.0500 | Bachem | 0.5mg | EUR 273 |
Description: Sum Formula: C80H138N26O24S2; CAS# [150469-23-1] net |
![]() Prion Protein (106-126) (human) (scrambled) |
|||
H-4882.1000 | Bachem | 1.0mg | EUR 418 |
Description: Sum Formula: C80H138N26O24S2; CAS# [150469-23-1] net |
![]() Tide Fluor 2-LL-37 (scrambled) |
|||
H-8288.0100 | Bachem | 0.1mg | EUR 312 |
Description: Sum Formula: C205H340N60O53+dye |
![]() Tide Fluor 2-LL-37 (scrambled) |
|||
H-8288.0500 | Bachem | 0.5mg | EUR 1017 |
Description: Sum Formula: C205H340N60O53+dye |
![]() Lytic Peptide, Shiva ? 1 |
|||
SP-88327-1 | Alpha Diagnostics | 1 mg | EUR 347 |
![]() Brain natriuretic peptide (1-32) (human) |
|||
B5442-1 | ApexBio | 1 mg | EUR 518 |
![]() Amyloid Beta-Peptide (1-40) (human) |
|||
A1124-1 | ApexBio | 1 mg | EUR 189 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
![]() YAP-TEAD Inhibitor 1 (Peptide 17) |
|||
A1149-1 | ApexBio | 1 mg | EUR 235 |
![]() Human, mouse, rat connexin 37/40 hemi-channel Scrambled peptide (GAP26 domain) |
|||
Cx2602-PS-5 | Alpha Diagnostics | 5 mg | EUR 773 |
![]() JAG - 1 (188 - 204), Jagged - 1 (188 - 204), Notch Ligand (AA: Cys-Asp-Asp-Tyr-Tyr-Tyr-Gly-Phe-Gly-Cys-Asn-Lys-Phe-Cys-Arg-Pro-Arg) (MW: 2107.37) |
|||
SP-56614-1 | Alpha Diagnostics | 1 mg | EUR 164 |
![]() GnRH Associated Peptide (GAP) (1-13), human |
|||
A1020-1 | ApexBio | 1 mg | EUR 90 |
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP). |
![]() L202 pPLVPTH2- tTR- KRAB- Cerulean- scrambled- shRNA |
|||
PVT11123 | Lifescience Market | 2 ug | EUR 301 |
![]() Canine C-Peptide ELISA Kit |
|||
RD-C-Peptide-c-48Tests | Reddot Biotech | 48 Tests | EUR 533 |
![]() Canine C-Peptide ELISA Kit |
|||
RD-C-Peptide-c-96Tests | Reddot Biotech | 96 Tests | EUR 740 |
![]() Human C-Peptide ELISA Kit |
|||
RD-C-Peptide-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 387 |
![]() Human C-Peptide ELISA Kit |
|||
RD-C-Peptide-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 532 |
![]() Mouse C-Peptide ELISA Kit |
|||
RD-C-Peptide-Mu-48Tests | Reddot Biotech | 48 Tests | EUR 446 |
![]() Mouse C-Peptide ELISA Kit |
|||
RD-C-Peptide-Mu-96Tests | Reddot Biotech | 96 Tests | EUR 615 |
![]() Rat C-Peptide ELISA Kit |
|||
RD-C-Peptide-Ra-48Tests | Reddot Biotech | 48 Tests | EUR 465 |
![]() Rat C-Peptide ELISA Kit |
|||
RD-C-Peptide-Ra-96Tests | Reddot Biotech | 96 Tests | EUR 643 |
![]() Canine C-Peptide ELISA Kit |
|||
DLR-C-Peptide-c-48T | DL Develop | 48T | EUR 527 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
![]() Canine C-Peptide ELISA Kit |
|||
DLR-C-Peptide-c-96T | DL Develop | 96T | EUR 688 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
![]() Human C-Peptide ELISA Kit |
|||
DLR-C-Peptide-Hu-48T | DL Develop | 48T | EUR 398 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
![]() Human C-Peptide ELISA Kit |
|||
DLR-C-Peptide-Hu-96T | DL Develop | 96T | EUR 511 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
![]() Mouse C-Peptide ELISA Kit |
|||
DLR-C-Peptide-Mu-48T | DL Develop | 48T | EUR 450 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
![]() Mouse C-Peptide ELISA Kit |
|||
DLR-C-Peptide-Mu-96T | DL Develop | 96T | EUR 582 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
![]() Rat C-Peptide ELISA Kit |
|||
DLR-C-Peptide-Ra-48T | DL Develop | 48T | EUR 467 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
![]() Rat C-Peptide ELISA Kit |
|||
DLR-C-Peptide-Ra-96T | DL Develop | 96T | EUR 605 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
![]() Canine C-Peptide ELISA Kit |
|||
RDR-C-Peptide-c-48Tests | Reddot Biotech | 48 Tests | EUR 557 |
![]() Canine C-Peptide ELISA Kit |
|||
RDR-C-Peptide-c-96Tests | Reddot Biotech | 96 Tests | EUR 774 |
![]() Human C-Peptide ELISA Kit |
|||
RDR-C-Peptide-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 404 |
![]() Human C-Peptide ELISA Kit |
|||
RDR-C-Peptide-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 556 |
![]() Mouse C-Peptide ELISA Kit |
|||
RDR-C-Peptide-Mu-48Tests | Reddot Biotech | 48 Tests | EUR 465 |
![]() Mouse C-Peptide ELISA Kit |
|||
RDR-C-Peptide-Mu-96Tests | Reddot Biotech | 96 Tests | EUR 643 |
![]() Rat C-Peptide ELISA Kit |
|||
RDR-C-Peptide-Ra-48Tests | Reddot Biotech | 48 Tests | EUR 486 |
![]() Rat C-Peptide ELISA Kit |
|||
RDR-C-Peptide-Ra-96Tests | Reddot Biotech | 96 Tests | EUR 672 |
![]() GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein |
|||
PROTP01275-1 | BosterBio | Regular: 50ug | EUR 317 |
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques. |
![]() SAMS Peptide |
|||
B5097-1 | ApexBio | 1 mg | EUR 222 |
![]() Rhodopsin peptide |
|||
A1087-1 | ApexBio | 1 mg | EUR 131 |
Description: Rhodopsin peptide,(C51H88N14O20), a peptide with the sequence H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH, MW= 1217.33. Rhodopsin, also known as visual purple, is a biological pigment in photoreceptor cells of the retina that is responsible for the first events in the perception of light. |
![]() Atrial Natriuretic Peptide (1-28), Rat |
|||
SP-55278-1 | Alpha Diagnostics | 0.5 mg | EUR 286 |
![]() C-type natriuretic peptide (1-22) (human, rat, swine) |
|||
B5441-1 | ApexBio | 1 mg | EUR 276 |
![]() Scrambled sgRNA CRISPR/Cas9 All-in-One Lentivector |
|||
K010 | ABM | 1.0 ug | EUR 154 |
![]() L201 pLVPTH2- tTR- KRAB- Cerulean- scrambled- shRNA- Control |
|||
PVT11122 | Lifescience Market | 2 ug | EUR 301 |
![]() Eledoisin-Related Peptide |
|||
B5233-1 | ApexBio | 1 mg | EUR 155 |
![]() MLCK inhibitor peptide |
|||
B5236-1 | ApexBio | 1 mg | EUR 184 |
![]() Lyn peptide inhibitor |
|||
B5285-1 | ApexBio | 1 mg | EUR 601 |
![]() Compstatin control peptide |
|||
B5478-1 | ApexBio | 1 mg | EUR 373 |
![]() DAPK Substrate Peptide |
|||
A4469-1 | ApexBio | 1 mg | EUR 292 |
Description: Synthetic peptide substrate for death associated protein kinase (DAPK) (Km = 9 ?M). |
![]() Calcineurin Autoinhibitory Peptide |
|||
A4532-1 | ApexBio | 1 mg | EUR 399 |
Description: Selective inhibitor of Ca2+-calmodulin-dependent protein phosphatase (calcineurin) (IC50 ~ 10 mM). Does not inhibit PP1, PP2A or CaM kinase II (IC50 > 100 mM). |
We describe and validate a brand new membrane protein topology prediction technique, TMHMM, primarily based on a hidden Markov mannequin. We current an in depth evaluation of TMHMM’s efficiency, and present that it appropriately predicts 97-98 % of the transmembrane helices.
Moreover, TMHMM can discriminate between soluble and membrane proteins with each specificity and sensitivity higher than 99 %, though the accuracy drops when sign peptides are current. This excessive diploma of accuracy allowed us to foretell reliably integral membrane proteins in a big assortment of genomes. Based mostly on these predictions, we estimate that 20-30 % of all genes in most genomes encode membrane proteins, which is in settlement with earlier estimates.
Human Angiopoietin Like Protein 2 (ANGPTL2) Protein |
We additional found that proteins with N(in)-C(in) topologies are strongly most popular in all examined organisms, besides Caenorhabditis elegans, the place the big variety of 7TM receptors will increase the counts for N(out)-C(in) topologies. We talk about the doable relevance of this discovering for our understanding of membrane protein meeting mechanisms. A TMHMM prediction service is offered at http://www.cbs.dtu.dk/providers/TMHMM/.
Morphological changes seen in OA embrace cartilage erosion along with a variable diploma of synovial irritation. Current evaluation attributes these changes to a fancy group of biochemical parts, along with proteolytic enzymes, that lead to a breakdown of the cartilage macromolecules. Cytokines akin to IL-1 and TNF-alpha produced by activated synoviocytes, mononuclear cells or by articular cartilage itself significantly up-regulate metalloproteinases (MMP) gene expression.
- Cytokines moreover blunt chondrocyte compensatory synthesis pathways required to revive the integrity of the degraded extrecellular matrix (ECM). Moreover, in OA synovium, a relative deficit inside the manufacturing of pure antagonists of the IL-1 receptor (IL-1Ra) has been demonstrated, and can presumably be related to an additional manufacturing of nitric oxide in OA tissues.
- This, coupled with an upregulation inside the receptor stage, has been confirmed to be an extra enhancer of the catabolic affect of IL-1 on this sickness.IL-1 and TNF-alpha significantly up-regulate MMP-Three steady-state mRNA derived from human synovium and chondrocytes.
- The neutralization of IL-1 and/or TNF-alpha up-regulation of MMP gene expression appears to be a logical enchancment inside the potential medical treatment of OA. Actually, recombinant IL-1receptor antagonists (ILRa) and soluble IL-1 receptor proteins have been examined in every animal fashions of OA for modification of OA improvement.
- Soluble IL-1Ra suppressed MMP-Three transcription inside the rabbit synovial cell line HIG-82. Experimental proof displaying that neutralizing TNF-alpha suppressed cartilage degradation in arthritis moreover assist such method.
- The important place of TNF-alpha in OA may emerge from the reality that human articular chondrocytes from OA cartilage expressed a significantly better number of the p55 TNF-alpha receptor which could make OA cartilage considerably susceptible to TNF-alpha degradative stimuli.
- In addition to, OA cartilage produces further TNF-alpha and TNF anglealpha convertase enzyme (TACE) mRNA than common cartilage. By analogy, an inhibitor to the p55 TNF-alpha receptor may also current a mechanism for abolishing TNF-alpha-induced degradation of cartilage ECM by MMPs.
- Since TACE is the regulator of TNF-alpha train, limiting the train of TACE may also present efficacious in OA. IL-1 and TNF-alpha inhibition of chondrocyte compensatory biosynthesis pathways which further compromise cartilage restore ought to even be dealt with, possibly by utilizing stimulatory brokers akin to transforming improvement factor-beta or insulin-like improvement factor-I.
- Positive cytokines have antiinflammatory properties. Three such cytokines – IL-4, IL-10, and IL-13 – have been acknowledged as able to modulate quite a few inflammatory processes. Their antiinflammatory potential, nonetheless, appears to rely vastly on the aim cell.
- Interleukin-4 (IL-4) has been examined in vitro in OA tissue and has been confirmed to suppress the synthesis of every TNF-alpha and IL-1beta within the similar technique as low-dose dexamethasone. Naturally occurring antiinflammatory cytokines akin to IL-10 inhibit the synthesis of IL-1 and TNF-alpha and is likely to be potential targets for treatment in OA.
- Augmenting inhibitor manufacturing in situ by gene treatment or supplementing it by injecting the recombinant protein is a ravishing therapeutic aim, although an in vivo assay in OA is simply not obtainable, and its applicability has however to be confirmed.
- Equally, IL-13 significantly inhibits lipopolysaccharide (LPS)-induced TNF-alpha manufacturing by mononuclear cells from peripheral blood, nonetheless not in cells from contaminated synovial fluid. IL-13 has important natural actions: inhibition of the manufacturing of a wide range of proinflammatory cytokines in monocytes/macrophages, B cells, pure killer cells and endothelial cells, whereas rising IL-1Ra manufacturing.
- In OA synovial membranes dealt with with LPS, IL-13 inhibited the synthesis of IL-1beta, TNF-alpha and stromelysin, whereas rising IL-1Ra manufacturing.
- In summary, modulation of cytokines that administration MMP gene up-regulation would appear like fertile targets for drug enchancment inside the remedy of OA. Quite a lot of analysis illustrate the potential significance of modulating IL-1 train as a option to in the reduction of the event of the structural changes in OA.
- Throughout the experimental canine and rabbit fashions of OA, we have got demonstrated that in vivo intraarticular injections of the IL-Ra gene can forestall the event of structural changes in OA. Future directions inside the evaluation and remedy of osteoarthritis (OA) will probably be based totally on the rising picture of pathophysiological events that modulate the initiation and improvement of OA.
![]() anti-Angiopoietin like 7 |
|||
LF-PA10021 | Abfrontier | 50 ug | EUR 363 |
Description: Mouse polyclonal to Angiopoietin like 7 |
![]() Mouse Angiopoietin Like Protein 2 ELISA kit |
|||
E03A0505-192T | BlueGene | 192 tests | EUR 1270 |
Description: A competitive ELISA for quantitative measurement of Mouse Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Mouse Angiopoietin Like Protein 2 ELISA kit |
|||
E03A0505-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A competitive ELISA for quantitative measurement of Mouse Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Mouse Angiopoietin Like Protein 2 ELISA kit |
|||
E03A0505-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A competitive ELISA for quantitative measurement of Mouse Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Recombinant Angiopoietin Like Protein 2 (ANGPTL2) |
|||
4-RPB919Hu01 | Cloud-Clone |
|
|
Description: Recombinant Human Angiopoietin Like Protein 2 expressed in: E.coli |
![]() Recombinant Angiopoietin Like Protein 2 (ANGPTL2) |
|||
4-RPB919Mu01 | Cloud-Clone |
|
|
Description: Recombinant Mouse Angiopoietin Like Protein 2 expressed in: E.coli |
![]() Recombinant Angiopoietin Like Protein 2 (ANGPTL2) |
|||
4-RPB919Ra01 | Cloud-Clone |
|
|
Description: Recombinant Rat Angiopoietin Like Protein 2 expressed in: E.coli |
![]() Recombinant Angiopoietin Like Protein 2 (ANGPTL2) |
|||
4-RPB919Ra02 | Cloud-Clone |
|
|
Description: Recombinant Rat Angiopoietin Like Protein 2 expressed in: E.coli |
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody |
|||
20-abx130201 | Abbexa |
|
|
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody |
|||
20-abx110975 | Abbexa |
|
|
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody |
|||
20-abx318439 | Abbexa |
|
|
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody |
|||
20-abx103089 | Abbexa |
|
|
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody |
|||
20-abx103090 | Abbexa |
|
|
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody |
|||
20-abx103091 | Abbexa |
|
|
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody |
|||
20-abx211819 | Abbexa |
|
|
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody |
|||
20-abx175386 | Abbexa |
|
|
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody |
|||
20-abx171222 | Abbexa |
|
|
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody |
|||
20-abx301744 | Abbexa |
|
|
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody |
|||
abx230397-100ug | Abbexa | 100 ug | EUR 481 |
![]() Anti-Angiopoietin-like 4 Antibody |
|||
STJ500081 | St John's Laboratory | 100 µg | EUR 476 |
![]() ANGPTL3 (243-460) Angiopoietin-like Protein 3 (243-460 a.a.) Human Recombinant Protein |
|||
PROTQ9Y5C1-2 | BosterBio | Regular: 20ug | EUR 317 |
Description: ANGPTL3 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 239 amino acids (243-460 a.a) and having a molecular mass of 27.7kDa. ANGPTL3 is fused to a 21 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques. |
![]() Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit |
|||
SEB919Mu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 4626.78 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Angiopoietin Like Protein 2 (ANGPTL2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
![]() Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit |
|||
SEB919Mu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 468.68 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Angiopoietin Like Protein 2 (ANGPTL2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
![]() Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit |
|||
SEB919Mu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 626.68 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Angiopoietin Like Protein 2 (ANGPTL2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
![]() Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit |
|||
SEB919Mu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 2520.06 |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Angiopoietin Like Protein 2 (ANGPTL2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
![]() Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit |
|||
4-SEB919Mu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Angiopoietin Like Protein 2 (ANGPTL2) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species. |
![]() Mouse Angiopoietin Like Protein 2 ELISA Kit (ANGPTL2) |
|||
RK02595 | Abclonal | 96 Tests | EUR 521 |
![]() Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit |
|||
RD-ANGPTL2-Mu-48Tests | Reddot Biotech | 48 Tests | EUR 511 |
![]() Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit |
|||
RD-ANGPTL2-Mu-96Tests | Reddot Biotech | 96 Tests | EUR 709 |
![]() Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit |
|||
DLR-ANGPTL2-Mu-48T | DL Develop | 48T | EUR 508 |
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Angiopoietin Like Protein 2 (ANGPTL2) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
![]() Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit |
|||
DLR-ANGPTL2-Mu-96T | DL Develop | 96T | EUR 661 |
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Angiopoietin Like Protein 2 (ANGPTL2) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
![]() Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit |
|||
abx575925-96tests | Abbexa | 96 tests | EUR 833 |
![]() Mouse Angiopoietin Like Protein 2 (ANGPTL2) CLIA Kit |
|||
20-abx493252 | Abbexa |
|
|
![]() Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit |
|||
abx518830-96tests | Abbexa | 96 tests | EUR 707 |
![]() Mouse Angiopoietin Like Protein 2 (ANGPTL2) CLIA Kit |
|||
abx195202-96tests | Abbexa | 96 tests | EUR 825 |
![]() Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit |
|||
abx255181-96tests | Abbexa | 96 tests | EUR 707 |
![]() Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit |
|||
20-abx153639 | Abbexa |
|
|
![]() Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit |
|||
RDR-ANGPTL2-Mu-48Tests | Reddot Biotech | 48 Tests | EUR 534 |
![]() Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit |
|||
RDR-ANGPTL2-Mu-96Tests | Reddot Biotech | 96 Tests | EUR 742 |
![]() Mouse ANGPTL2(Angiopoietin Like Protein 2) ELISA Kit |
|||
EM0835 | FN Test | 96T | EUR 524.1 |
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 18.75pg/ml |
![]() Human Angiopoietin Like Protein 2 (ANGPTL2) Protein |
|||
20-abx065329 | Abbexa |
|
|
![]() Rat Angiopoietin Like Protein 2 (ANGPTL2) Protein |
|||
20-abx065330 | Abbexa |
|
|
![]() Rat Angiopoietin Like Protein 2 (ANGPTL2) Protein |
|||
20-abx065331 | Abbexa |
|
|
![]() Anti-Visinin-like Protein 1 Antibody |
|||
M06959-2 | BosterBio | 100ul | EUR 397 |
Description: Rabbit Polyclonal Visinin-like Protein 1 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse, Rat. |
![]() Mouse Angiopoietin-like protein 8 (Angptl8) |
|||
1-CSB-YP844436MO | Cusabio |
|
|
Description: Recombinant Mouse Angiopoietin-like protein 8(Angptl8) expressed in Yeast |
![]() Mouse Angiopoietin-like protein 8 (Angptl8) |
|||
1-CSB-EP844436MO | Cusabio |
|
|
Description: Recombinant Mouse Angiopoietin-like protein 8(Angptl8) expressed in E.coli |
![]() Rabbit Polyclonal antibody Anti-CRBN |
|||
Anti-CRBN | ImmunoStep | 50 µg | EUR 349 |
![]() anti- Angiopoietin 2 antibody |
|||
FNab00392 | FN Test | 100µg | EUR 585 |
Description: Antibody raised against Angiopoietin 2 |
![]() Anti-Angiopoietin 2 antibody |
|||
PAab00392 | Lifescience Market | 100 ug | EUR 412 |
![]() Anti-Angiopoietin-2 Antibody |
|||
A1291-100 | Biovision | EUR 370 |
![]() Angiopoietin Like Protein 2 (ANGPTL2) Polyclonal Antibody (Mouse, Rat) |
|||
4-PAB919Mu01 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Mouse, Rat Angiopoietin Like Protein 2 (ANGPTL2) |
![]() ELISA kit for Mouse ANGPTL2 (Angiopoietin Like Protein 2) |
|||
E-EL-M0092 | Elabscience Biotech | 1 plate of 96 wells | EUR 534 |
Description: A sandwich ELISA kit for quantitative measurement of Mouse ANGPTL2 (Angiopoietin Like Protein 2) in samples from Serum, Plasma, Cell supernatant |
![]() CLIA kit for Mouse ANGPTL2 (Angiopoietin Like Protein 2) |
|||
E-CL-M0079 | Elabscience Biotech | 1 plate of 96 wells | EUR 584 |
Description: A sandwich CLIA kit for quantitative measurement of Mouse ANGPTL2 (Angiopoietin Like Protein 2) in samples from Serum, Plasma, Cell supernatant |
![]() ELISA kit for Mouse ANGPTL2 (Angiopoietin Like Protein 2) |
|||
ELK3189 | ELK Biotech | 1 plate of 96 wells | EUR 432 |
Description: A sandwich ELISA kit for detection of Angiopoietin Like Protein 2 from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody (HRP) |
|||
20-abx312179 | Abbexa |
|
|
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody (FITC) |
|||
20-abx312180 | Abbexa |
|
|
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody (Biotin) |
|||
20-abx312181 | Abbexa |
|
|
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody (HRP) |
|||
20-abx312182 | Abbexa |
|
|
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody (FITC) |
|||
20-abx312183 | Abbexa |
|
|
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody (Biotin) |
|||
20-abx312184 | Abbexa |
|
|
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody (Biotin) |
|||
20-abx272211 | Abbexa |
|
|
![]() Angiopoietin Like Protein 2 (ANGPTL2) Antibody (Biotin) |
|||
20-abx273366 | Abbexa |
|
|
![]() Human Angiopoietin Like Protein 2 ELISA kit |
|||
E01A0505-192T | BlueGene | 192 tests | EUR 1270 |
Description: A competitive ELISA for quantitative measurement of Human Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Human Angiopoietin Like Protein 2 ELISA kit |
|||
E01A0505-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A competitive ELISA for quantitative measurement of Human Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Human Angiopoietin Like Protein 2 ELISA kit |
|||
E01A0505-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A competitive ELISA for quantitative measurement of Human Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Rabbit Angiopoietin Like Protein 2 ELISA kit |
|||
E04A0505-192T | BlueGene | 192 tests | EUR 1270 |
Description: A competitive ELISA for quantitative measurement of Rabbit Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Rabbit Angiopoietin Like Protein 2 ELISA kit |
|||
E04A0505-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A competitive ELISA for quantitative measurement of Rabbit Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Rabbit Angiopoietin Like Protein 2 ELISA kit |
|||
E04A0505-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A competitive ELISA for quantitative measurement of Rabbit Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Rat Angiopoietin Like Protein 2 ELISA kit |
|||
E02A0505-192T | BlueGene | 192 tests | EUR 1270 |
Description: A competitive ELISA for quantitative measurement of Rat Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Rat Angiopoietin Like Protein 2 ELISA kit |
|||
E02A0505-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A competitive ELISA for quantitative measurement of Rat Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Rat Angiopoietin Like Protein 2 ELISA kit |
|||
E02A0505-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A competitive ELISA for quantitative measurement of Rat Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Goat Angiopoietin Like Protein 2 ELISA kit |
|||
E06A0505-192T | BlueGene | 192 tests | EUR 1270 |
Description: A competitive ELISA for quantitative measurement of Goat Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Goat Angiopoietin Like Protein 2 ELISA kit |
|||
E06A0505-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A competitive ELISA for quantitative measurement of Goat Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Goat Angiopoietin Like Protein 2 ELISA kit |
|||
E06A0505-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A competitive ELISA for quantitative measurement of Goat Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Pig Angiopoietin Like Protein 2 ELISA kit |
|||
E07A0505-192T | BlueGene | 192 tests | EUR 1270 |
Description: A competitive ELISA for quantitative measurement of Porcine Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Pig Angiopoietin Like Protein 2 ELISA kit |
|||
E07A0505-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A competitive ELISA for quantitative measurement of Porcine Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Pig Angiopoietin Like Protein 2 ELISA kit |
|||
E07A0505-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A competitive ELISA for quantitative measurement of Porcine Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Dog Angiopoietin Like Protein 2 ELISA kit |
|||
E08A0505-192T | BlueGene | 192 tests | EUR 1270 |
Description: A competitive ELISA for quantitative measurement of Canine Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Dog Angiopoietin Like Protein 2 ELISA kit |
|||
E08A0505-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A competitive ELISA for quantitative measurement of Canine Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Dog Angiopoietin Like Protein 2 ELISA kit |
|||
E08A0505-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A competitive ELISA for quantitative measurement of Canine Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Monkey Angiopoietin Like Protein 2 ELISA kit |
|||
E09A0505-192T | BlueGene | 192 tests | EUR 1270 |
Description: A competitive ELISA for quantitative measurement of Monkey Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Monkey Angiopoietin Like Protein 2 ELISA kit |
|||
E09A0505-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A competitive ELISA for quantitative measurement of Monkey Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Monkey Angiopoietin Like Protein 2 ELISA kit |
|||
E09A0505-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A competitive ELISA for quantitative measurement of Monkey Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Anti-Angiopoietin-like 4/ANGPTL4 Antibody |
|||
PA1435 | BosterBio | 100ug/vial | EUR 294 |
![]() Anti-Angiopoietin-like 4 Antibody BIOTIN |
|||
STJ500082 | St John's Laboratory | 100 µg | EUR 586 |