
Predicting transmembrane protein topology with a hidden Markov mannequin: utility to finish genomes


A technique has been devised for the electrophoretic switch of proteins from polyacrylamide gels to nitrocellulose sheets. The strategy leads to quantitative switch of ribosomal proteins from gels containing urea. For sodium dodecyl sulfate gels, the unique band sample was obtained with no lack of decision, however the switch was not quantitative.
The strategy permits detection of proteins by autoradiography and is easier than standard procedures. The immobilized proteins have been detectable by immunological procedures. All further binding capability on the nitrocellulose was blocked with extra protein; then a particular antibody was sure and, lastly, a second antibody directed towards the primary antibody

Human, mouse, rat connexin 37/40 hemi-channel Scrambled peptide (GAP26 area)



. The second antibody was both radioactively labeled or conjugated to fluorescein or to peroxidase. The particular protein was then detected by both autoradiography, underneath UV mild, or by the peroxidase response product, respectively. Within the latter case, as little as 100 pg of protein was clearly detectable. It’s anticipated that the process might be relevant to evaluation of all kinds of proteins with particular reactions or ligands.

Human NEP1-40 of Nogo-66 peptide Scrambled peptide management for NEP140 >95% pure

Proof has collected that cytokines have a elementary place inside the differentiation of memory T cells. Proper right here, we observe the CD8+ T cell from preliminary activation to memory-cell expertise, indicating the checkpoints at which cytokines resolve the future of the T cell.

Members of the frequent cytokine-receptor gamma-chain (gammac)-cytokine family–in specific, interleukin-7 (IL-7) and IL-15–act at each stage of the immune response to promote proliferation and survival. On this technique, a safe and defending, long-lived memory CD8+ T-cell pool is likely to be propagated and maintained.


Human, mouse, rat connexin 32 hemi-channel-scrambled peptide

Cx3212-PS-1 1 mg
EUR 263

Human, mouse, rat connexin 32 hemi-channel-Scrambled peptide (GAP24 domain)

Cx2410-PS-1 1 mg
EUR 286

Human, mouse, rat connexin 43 hemi-channel-Scrambled peptide (GAP26 domain)

Cx2606-PS-1 1 mg
EUR 286

Human, mouse, rat connexin 43 and 37 scrambled peptide (GAP27 domain)

Cx2704-PS-1 1 mg
EUR 263

Human, mouse, rat connexin 40 hemi-channel-Scrambled peptide (GAP27 domain)

Cx2708-PS-1 1 mg
EUR 263

3-D Life Scrambled RGD Peptide

09-P-003 1 µmol
EUR 121

3-D Life Scrambled RGD Peptide

P11-3 3x 1 µmol
EUR 276

Human, mouse, rat connexin 37/40 hemi-channel Scrambled peptide (GAP26 domain)

Cx2602-PS-1 1 mg
EUR 286

Scrambled 10Panx

A2701-10 10 mg
EUR 258
Description: Scrambled 10Panx is the scrambled form of 10Panx (WRQAAFVDSY), a mimetic peptide of pannexin 1 that inhibits dye uptake by macrophages without affecting cellular membrane currents.

Scrambled 10Panx

A2701-25 25 mg
EUR 514
Description: Scrambled 10Panx is the scrambled form of 10Panx (WRQAAFVDSY), a mimetic peptide of pannexin 1 that inhibits dye uptake by macrophages without affecting cellular membrane currents.

Scrambled 10Panx

A2701-5 5 mg
EUR 166
Description: Scrambled 10Panx is the scrambled form of 10Panx (WRQAAFVDSY), a mimetic peptide of pannexin 1 that inhibits dye uptake by macrophages without affecting cellular membrane currents.

LL-37 (scrambled)

H-7886.0500 0.5mg
EUR 283
Description: Sum Formula: C205H340N60O53; CAS# [1354065-56-7] net

LL-37 (scrambled)

H-7886.1000 1.0mg
EUR 441
Description: Sum Formula: C205H340N60O53; CAS# [1354065-56-7] net

Scrambled TRAP Fragment

5-01910 4 x 5mg Ask for price

JAG - 1 (188 - 204), Jagged – 1 (188 - 204), Notch Ligand

5-01413 4 x 1mg Ask for price

Amyloid b-Protein (1-42) (scrambled)

H-7406.0500 0.5mg
EUR 441
Description: Sum Formula: C203H311N55O60S; CAS# [1678415-52-5] net

Amyloid b-Protein (1-42) (scrambled)

H-7406.1000 1.0mg
EUR 589
Description: Sum Formula: C203H311N55O60S; CAS# [1678415-52-5] net

Amyloid b-Protein (1-40) (scrambled)

H-7408.0500 0.5mg
EUR 335
Description: Sum Formula: C194H295N53O58S; CAS# [1678415-68-3] net

Amyloid b-Protein (1-40) (scrambled)

H-7408.1000 1.0mg
EUR 606
Description: Sum Formula: C194H295N53O58S; CAS# [1678415-68-3] net

Human, mouse, rat connexin 32 hemi-channel-scrambled peptide

Cx3212-PS-5 5 mg
EUR 773

Scrambled sgRNA CRISPR Lentivector

K018 1.0 ug
EUR 154

PAR-2 (1-6) amide (human) (scrambled)

H-6428.0025 25.0mg
EUR 321
Description: Sum Formula: C28H54N8O7; CAS# [1348395-60-7] net

PAR-2 (1-6) amide (human) (scrambled)

H-6428.0100 100.0mg
EUR 902
Description: Sum Formula: C28H54N8O7; CAS# [1348395-60-7] net

R-JAG (188 - 206) R - Jagged -1(188 - 206), Notch Ligand

5-01864 4 x 1mg Ask for price

5-FAM-LL-37 (scrambled)

H-7888.0500 0.5mg
EUR 466
Description: Sum Formula: C226H350N60O59; CAS# [2022972-73-0] net

5-FAM-LL-37 (scrambled)

H-7888.1000 1.0mg
EUR 776
Description: Sum Formula: C226H350N60O59; CAS# [2022972-73-0] net

Biotinyl-eAhx-LL-37 (scrambled)

H-7896.0500 0.5mg
EUR 452
Description: Sum Formula: C221H365N63O56S; CAS# [2022972-72-9] net

Biotinyl-eAhx-LL-37 (scrambled)

H-7896.1000 1.0mg
EUR 747
Description: Sum Formula: C221H365N63O56S; CAS# [2022972-72-9] net

Tet-pLKO-Puro-Scrambled Plasmid

PVT14797 2 ug
EUR 370

Amyloid ?-Peptide (1-42) (human)

B6057-.1 100 ug
EUR 276

HIV-1 Tat Protein Peptide

B1433-1 1 mg
EUR 128
Description: HIV-1 Tat Protein Peptide

Human NEP1-40 of Nogo-66 peptide, Scrambled peptide control for NEP140, >95% pure

NEP140-115 100 ug
EUR 286

Human NEP1-40 of Nogo-66 peptide Scrambled peptide control for NEP140 >95% pure

NEP140-115-1000 1000 ug
EUR 773

Human, mouse, rat connexin 32 hemi-channel-Scrambled peptide (GAP24 domain)

Cx2410-PS-5 5 mg
EUR 773

Human, mouse, rat connexin 43 hemi-channel-Scrambled peptide (GAP26 domain)

Cx2606-PS-5 5 mg
EUR 773

Human, mouse, rat connexin 43 and 37 scrambled peptide (GAP27 domain)

Cx2704-PS-5 5 mg
EUR 773

Human, mouse, rat connexin 40 hemi-channel-Scrambled peptide (GAP27 domain)

Cx2708-PS-5 5 mg
EUR 773

5-FAM-Amyloid b-Protein (1-42) (scrambled)

H-7836.0100 0.1mg
EUR 160
Description: Sum Formula: C224H321N55O66S

5-FAM-Amyloid b-Protein (1-42) (scrambled)

H-7836.0500 0.5mg
EUR 495
Description: Sum Formula: C224H321N55O66S

Teplow's Amyloid b-Protein (1-40) (scrambled II)

H-8278.0100 0.1mg
EUR 142
Description: Sum Formula: C194H295N53O58S

Teplow's Amyloid b-Protein (1-40) (scrambled II)

H-8278.0500 0.5mg
EUR 418
Description: Sum Formula: C194H295N53O58S

Teplow's Amyloid b-Protein (1-42) (scrambled II)

H-8282.0500 0.5mg
EUR 418
Description: Sum Formula: C203H311N55O60S

Teplow's Amyloid b-Protein (1-42) (scrambled II)

H-8282.1000 1.0mg
EUR 612
Description: Sum Formula: C203H311N55O60S

Lytic Peptide, Shiva ? 1

SP-88327-1 1 mg
EUR 347

Brain natriuretic peptide (1-32) (human)

B5442-1 1 mg
EUR 518

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

YAP-TEAD Inhibitor 1 (Peptide 17)

A1149-1 1 mg
EUR 235

Human, mouse, rat connexin 37/40 hemi-channel Scrambled peptide (GAP26 domain)

Cx2602-PS-5 5 mg
EUR 773

Prion Protein (106-126) (human) (scrambled)

H-4882.0500 0.5mg
EUR 273
Description: Sum Formula: C80H138N26O24S2; CAS# [150469-23-1] net

Prion Protein (106-126) (human) (scrambled)

H-4882.1000 1.0mg
EUR 418
Description: Sum Formula: C80H138N26O24S2; CAS# [150469-23-1] net

Tide Fluor 2-LL-37 (scrambled)

H-8288.0100 0.1mg
EUR 312
Description: Sum Formula: C205H340N60O53+dye

Tide Fluor 2-LL-37 (scrambled)

H-8288.0500 0.5mg
EUR 1017
Description: Sum Formula: C205H340N60O53+dye

GnRH Associated Peptide (GAP) (1-13), human

A1020-1 1 mg
EUR 90
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP).

SAMS Peptide

B5097-1 1 mg
EUR 222

Rhodopsin peptide

A1087-1 1 mg
EUR 131
Description: Rhodopsin peptide,(C51H88N14O20), a peptide with the sequence H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH, MW= 1217.33. Rhodopsin, also known as visual purple, is a biological pigment in photoreceptor cells of the retina that is responsible for the first events in the perception of light.

JAG - 1 (188 - 204), Jagged - 1 (188 - 204), Notch Ligand (AA: Cys-Asp-Asp-Tyr-Tyr-Tyr-Gly-Phe-Gly-Cys-Asn-Lys-Phe-Cys-Arg-Pro-Arg) (MW: 2107.37)

SP-56614-1 1 mg
EUR 164

Canine C-Peptide ELISA Kit

DLR-C-Peptide-c-48T 48T
EUR 527
  • Should the Canine C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit

DLR-C-Peptide-c-96T 96T
EUR 688
  • Should the Canine C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-48T 48T
EUR 398
  • Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-96T 96T
EUR 511
  • Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit

DLR-C-Peptide-Mu-48T 48T
EUR 450
  • Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit

DLR-C-Peptide-Mu-96T 96T
EUR 582
  • Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit

DLR-C-Peptide-Ra-48T 48T
EUR 467
  • Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit

DLR-C-Peptide-Ra-96T 96T
EUR 605
  • Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit

RD-C-Peptide-c-48Tests 48 Tests
EUR 533

Canine C-Peptide ELISA Kit

RD-C-Peptide-c-96Tests 96 Tests
EUR 740

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-48Tests 48 Tests
EUR 387

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-96Tests 96 Tests
EUR 532

Mouse C-Peptide ELISA Kit

RD-C-Peptide-Mu-48Tests 48 Tests
EUR 446

Mouse C-Peptide ELISA Kit

RD-C-Peptide-Mu-96Tests 96 Tests
EUR 615

Rat C-Peptide ELISA Kit

RD-C-Peptide-Ra-48Tests 48 Tests
EUR 465

Rat C-Peptide ELISA Kit

RD-C-Peptide-Ra-96Tests 96 Tests
EUR 643

Canine C-Peptide ELISA Kit

RDR-C-Peptide-c-48Tests 48 Tests
EUR 557

Canine C-Peptide ELISA Kit

RDR-C-Peptide-c-96Tests 96 Tests
EUR 774

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-48Tests 48 Tests
EUR 404

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-96Tests 96 Tests
EUR 556

Mouse C-Peptide ELISA Kit

RDR-C-Peptide-Mu-48Tests 48 Tests
EUR 465

Mouse C-Peptide ELISA Kit

RDR-C-Peptide-Mu-96Tests 96 Tests
EUR 643

Rat C-Peptide ELISA Kit

RDR-C-Peptide-Ra-48Tests 48 Tests
EUR 486

Rat C-Peptide ELISA Kit

RDR-C-Peptide-Ra-96Tests 96 Tests
EUR 672

GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein

PROTP01275-1 Regular: 50ug
EUR 317
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques.

Atrial Natriuretic Peptide (1-28), Rat

SP-55278-1 0.5 mg
EUR 286

L202 pPLVPTH2- tTR- KRAB- Cerulean- scrambled- shRNA

PVT11123 2 ug
EUR 301

C-type natriuretic peptide (1-22) (human, rat, swine)

B5441-1 1 mg
EUR 276

Eledoisin-Related Peptide

B5233-1 1 mg
EUR 155

MLCK inhibitor peptide

B5236-1 1 mg
EUR 184

Lyn peptide inhibitor

B5285-1 1 mg
EUR 601




We describe and validate a brand new membrane protein topology prediction technique, TMHMM, primarily based on a hidden Markov mannequin. We current an in depth evaluation of TMHMM’s efficiency, and present that it appropriately predicts 97-98 % of the transmembrane helices.
Moreover, TMHMM can discriminate between soluble and membrane proteins with each specificity and sensitivity higher than 99 %, though the accuracy drops when sign peptides are current. This excessive diploma of accuracy allowed us to foretell reliably integral membrane proteins in a big assortment of genomes. Based mostly on these predictions, we estimate that 20-30 % of all genes in most genomes encode membrane proteins, which is in settlement with earlier estimates.

Human Angiopoietin Like Protein 2 (ANGPTL2) Protein

We additional found that proteins with N(in)-C(in) topologies are strongly most popular in all examined organisms, besides Caenorhabditis elegans, the place the big variety of 7TM receptors will increase the counts for N(out)-C(in) topologies. We talk about the doable relevance of this discovering for our understanding of membrane protein meeting mechanisms. A TMHMM prediction service is offered at


Morphological changes seen in OA embrace cartilage erosion along with a variable diploma of synovial irritation. Current evaluation attributes these changes to a fancy group of biochemical parts, along with proteolytic enzymes, that lead to a breakdown of the cartilage macromolecules. Cytokines akin to IL-1 and TNF-alpha produced by activated synoviocytes, mononuclear cells or by articular cartilage itself significantly up-regulate metalloproteinases (MMP) gene expression.
  1. Cytokines moreover blunt chondrocyte compensatory synthesis pathways required to revive the integrity of the degraded extrecellular matrix (ECM). Moreover, in OA synovium, a relative deficit inside the manufacturing of pure antagonists of the IL-1 receptor (IL-1Ra) has been demonstrated, and can presumably be related to an additional manufacturing of nitric oxide in OA tissues.
  2. This, coupled with an upregulation inside the receptor stage, has been confirmed to be an extra enhancer of the catabolic affect of IL-1 on this sickness.IL-1 and TNF-alpha significantly up-regulate MMP-Three steady-state mRNA derived from human synovium and chondrocytes.
  3. The neutralization of IL-1 and/or TNF-alpha up-regulation of MMP gene expression appears to be a logical enchancment inside the potential medical treatment of OA. Actually, recombinant IL-1receptor antagonists (ILRa) and soluble IL-1 receptor proteins have been examined in every animal fashions of OA for modification of OA improvement.
  4. Soluble IL-1Ra suppressed MMP-Three transcription inside the rabbit synovial cell line HIG-82. Experimental proof displaying that neutralizing TNF-alpha suppressed cartilage degradation in arthritis moreover assist such method.
  5. The important place of TNF-alpha in OA may emerge from the reality that human articular chondrocytes from OA cartilage expressed a significantly better number of the p55 TNF-alpha receptor which could make OA cartilage considerably susceptible to TNF-alpha degradative stimuli.
  6. In addition to, OA cartilage produces further TNF-alpha and TNF anglealpha convertase enzyme (TACE) mRNA than common cartilage. By analogy, an inhibitor to the p55 TNF-alpha receptor may also current a mechanism for abolishing TNF-alpha-induced degradation of cartilage ECM by MMPs.
  7. Since TACE is the regulator of TNF-alpha train, limiting the train of TACE may also present efficacious in OA. IL-1 and TNF-alpha inhibition of chondrocyte compensatory biosynthesis pathways which further compromise cartilage restore ought to even be dealt with, possibly by utilizing stimulatory brokers akin to transforming improvement factor-beta or insulin-like improvement factor-I.
  8. Positive cytokines have antiinflammatory properties. Three such cytokines – IL-4, IL-10, and IL-13 – have been acknowledged as able to modulate quite a few inflammatory processes. Their antiinflammatory potential, nonetheless, appears to rely vastly on the aim cell.
  9. Interleukin-4 (IL-4) has been examined in vitro in OA tissue and has been confirmed to suppress the synthesis of every TNF-alpha and IL-1beta within the similar technique as low-dose dexamethasone. Naturally occurring antiinflammatory cytokines akin to IL-10 inhibit the synthesis of IL-1 and TNF-alpha and is likely to be potential targets for treatment in OA.
  10. Augmenting inhibitor manufacturing in situ by gene treatment or supplementing it by injecting the recombinant protein is a ravishing therapeutic aim, although an in vivo assay in OA is simply not obtainable, and its applicability has however to be confirmed.
  11. Equally, IL-13 significantly inhibits lipopolysaccharide (LPS)-induced TNF-alpha manufacturing by mononuclear cells from peripheral blood, nonetheless not in cells from contaminated synovial fluid. IL-13 has important natural actions: inhibition of the manufacturing of a wide range of proinflammatory cytokines in monocytes/macrophages, B cells, pure killer cells and endothelial cells, whereas rising IL-1Ra manufacturing.
  12. In OA synovial membranes dealt with with LPS, IL-13 inhibited the synthesis of IL-1beta, TNF-alpha and stromelysin, whereas rising IL-1Ra manufacturing.
  13. In summary, modulation of cytokines that administration MMP gene up-regulation would appear like fertile targets for drug enchancment inside the remedy of OA. Quite a lot of analysis illustrate the potential significance of modulating IL-1 train as a option to in the reduction of the event of the structural changes in OA.
  14. Throughout the experimental canine and rabbit fashions of OA, we have got demonstrated that in vivo intraarticular injections of the IL-Ra gene can forestall the event of structural changes in OA. Future directions inside the evaluation and remedy of osteoarthritis (OA) will probably be based totally on the rising picture of pathophysiological events that modulate the initiation and improvement of OA.
Polyclonal Goat anti-GST μ-form
GST-ANTI-2 50 uL
EUR 280
Mouse Angiopoietin Like Protein 2 (ANGPTL2) Protein
  • EUR 676.00
  • EUR 286.00
  • EUR 2082.00
  • EUR 801.00
  • EUR 481.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
anti-Angiopoietin like 7
LF-PA10021 50 ug
EUR 363
Description: Mouse polyclonal to Angiopoietin like 7
Mouse Angiopoietin Like Protein 2 ELISA kit
E03A0505-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Angiopoietin Like Protein 2 ELISA kit
E03A0505-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Angiopoietin Like Protein 2 ELISA kit
E03A0505-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Anti-Angiopoietin-like 4 Antibody
STJ500081 100 µg
EUR 476
Angiopoietin Like Protein 2 (ANGPTL2) Antibody
  • EUR 439.00
  • EUR 133.00
  • EUR 1247.00
  • EUR 592.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody
  • EUR 732.00
  • EUR 398.00
  • 150 ul
  • 50 ul
  • Shipped within 5-10 working days.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody
  • EUR 815.00
  • EUR 425.00
  • 1 mg
  • 200 ug
  • Please enquire.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody
  • EUR 411.00
  • EUR 133.00
  • EUR 1149.00
  • EUR 565.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-12 working days.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody
  • EUR 425.00
  • EUR 133.00
  • EUR 1177.00
  • EUR 578.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody
  • EUR 439.00
  • EUR 133.00
  • EUR 1247.00
  • EUR 592.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-12 working days.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody
  • EUR 1177.00
  • EUR 578.00
  • 1 mg
  • 200 ug
  • Please enquire.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody
  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody
abx230397-100ug 100 ug
EUR 481
  • Shipped within 5-12 working days.
Recombinant Angiopoietin Like Protein 2 (ANGPTL2)
  • EUR 440.48
  • EUR 221.00
  • EUR 1376.80
  • EUR 525.60
  • EUR 951.20
  • EUR 358.00
  • EUR 3292.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Q9UKU9
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 28.0kDa
  • Isoelectric Point: 7.3
Description: Recombinant Human Angiopoietin Like Protein 2 expressed in: E.coli
Recombinant Angiopoietin Like Protein 2 (ANGPTL2)
  • EUR 485.28
  • EUR 233.00
  • EUR 1544.80
  • EUR 581.60
  • EUR 1063.20
  • EUR 388.00
  • EUR 3712.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Q9R045
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 30.5kDa
  • Isoelectric Point: 8.6
Description: Recombinant Mouse Angiopoietin Like Protein 2 expressed in: E.coli
Recombinant Angiopoietin Like Protein 2 (ANGPTL2)
  • EUR 535.46
  • EUR 246.00
  • EUR 1732.96
  • EUR 644.32
  • EUR 1188.64
  • EUR 421.00
  • EUR 4182.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Q9JJ03
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 20.3kDa
  • Isoelectric Point: Inquire
Description: Recombinant Rat Angiopoietin Like Protein 2 expressed in: E.coli
Recombinant Angiopoietin Like Protein 2 (ANGPTL2)
  • EUR 535.46
  • EUR 246.00
  • EUR 1732.96
  • EUR 644.32
  • EUR 1188.64
  • EUR 421.00
  • EUR 4182.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Q9JJ03
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 20.7kDa
  • Isoelectric Point: Inquire
Description: Recombinant Rat Angiopoietin Like Protein 2 expressed in: E.coli
ANGPTL3 (243-460) Angiopoietin-like Protein 3 (243-460 a.a.) Human Recombinant Protein
PROTQ9Y5C1-2 Regular: 20ug
EUR 317
Description: ANGPTL3 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 239 amino acids (243-460 a.a) and having a molecular mass of 27.7kDa. ANGPTL3 is fused to a 21 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit
abx518830-96tests 96 tests
EUR 707
  • Shipped within 5-12 working days.
Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit
abx575925-96tests 96 tests
EUR 833
  • Shipped within 5-12 working days.
Mouse ANGPTL2(Angiopoietin Like Protein 2) ELISA Kit
EM0835 96T
EUR 524.1
  • Detection range: 31.25-2000 pg/ml
  • Uniprot ID: Q9R045
  • Alias: ANGPTL2/ANGRP2/angiopoietin-like 2/Angiopoietin-like protein 2/angiopoietin-related protein 2/ARP2HARP/
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 18.75pg/ml
Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit
  • EUR 7237.00
  • EUR 3855.00
  • EUR 895.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.
Mouse Angiopoietin Like Protein 2 (ANGPTL2) CLIA Kit
abx195202-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.
Mouse Angiopoietin Like Protein 2 (ANGPTL2) CLIA Kit
  • EUR 8569.00
  • EUR 4560.00
  • EUR 1052.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.
Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit
abx255181-96tests 96 tests
EUR 707
  • Shipped within 5-12 working days.
Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit
EUR 508
  • Should the Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Angiopoietin Like Protein 2 (ANGPTL2) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit
EUR 661
  • Should the Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Angiopoietin Like Protein 2 (ANGPTL2) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit
SEB919Mu-10x96wellstestplate 10x96-wells test plate
EUR 4626.78
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Angiopoietin Like Protein 2 (ANGPTL2) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Angiopoietin Like Protein 2 (ANGPTL2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit
SEB919Mu-1x48wellstestplate 1x48-wells test plate
EUR 468.68
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Angiopoietin Like Protein 2 (ANGPTL2) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Angiopoietin Like Protein 2 (ANGPTL2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit
SEB919Mu-1x96wellstestplate 1x96-wells test plate
EUR 626.68
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Angiopoietin Like Protein 2 (ANGPTL2) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Angiopoietin Like Protein 2 (ANGPTL2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit
SEB919Mu-5x96wellstestplate 5x96-wells test plate
EUR 2520.06
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Angiopoietin Like Protein 2 (ANGPTL2) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Angiopoietin Like Protein 2 (ANGPTL2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit
  • EUR 4677.00
  • EUR 2471.00
  • EUR 627.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Angiopoietin Like Protein 2 elisa. Alternative names of the recognized antigen: HARP
  • ARP2
  • Angiopoietin-Related Protein 2
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Angiopoietin Like Protein 2 (ANGPTL2) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.
Mouse Angiopoietin Like Protein 2 ELISA Kit (ANGPTL2)
RK02595 96 Tests
EUR 521
Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit
RD-ANGPTL2-Mu-48Tests 48 Tests
EUR 511
Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit
RD-ANGPTL2-Mu-96Tests 96 Tests
EUR 709
Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit
RDR-ANGPTL2-Mu-48Tests 48 Tests
EUR 534
Mouse Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit
RDR-ANGPTL2-Mu-96Tests 96 Tests
EUR 742
Human Angiopoietin Like Protein 2 (ANGPTL2) Protein
  • EUR 620.00
  • EUR 272.00
  • EUR 1859.00
  • EUR 732.00
  • EUR 453.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Rat Angiopoietin Like Protein 2 (ANGPTL2) Protein
  • EUR 746.00
  • EUR 300.00
  • EUR 2332.00
  • EUR 885.00
  • EUR 523.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Rat Angiopoietin Like Protein 2 (ANGPTL2) Protein
  • EUR 746.00
  • EUR 300.00
  • EUR 2332.00
  • EUR 885.00
  • EUR 523.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-12 working days.
Anti-Visinin-like Protein 1 Antibody
M06959-2 100ul
EUR 397
Description: Rabbit Polyclonal Visinin-like Protein 1 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse, Rat.
Mouse Angiopoietin-like protein 8 (Angptl8)
  • EUR 504.00
  • EUR 265.00
  • EUR 1832.00
  • EUR 763.00
  • EUR 1216.00
  • EUR 334.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
  • MW: 22.5 kDa
  • Buffer composition: Tris-based buffer with 50% glycerol.
Description: Recombinant Mouse Angiopoietin-like protein 8(Angptl8) expressed in Yeast
Mouse Angiopoietin-like protein 8 (Angptl8)
  • EUR 505.00
  • EUR 265.00
  • EUR 1827.00
  • EUR 766.00
  • EUR 1218.00
  • EUR 335.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
  • MW: 24.5 kDa
  • Buffer composition: Tris-based buffer with 50% glycerol.
Description: Recombinant Mouse Angiopoietin-like protein 8(Angptl8) expressed in E.coli
anti- Angiopoietin 2 antibody
FNab00392 100µg
EUR 585
  • Recommended dilution: WB: 1:500-1:5000
  • IHC: 1:20-1:200
  • IP: 1:200-1:2000
  • Immunogen: angiopoietin 2
  • Uniprot ID: O15123
  • Research Area: Immunology, Cardiovascular, Developmental biology, Signal Transduction
Description: Antibody raised against Angiopoietin 2
Anti-Angiopoietin-2 Antibody
EUR 370
Anti-Angiopoietin 2 antibody
PAab00392 100 ug
EUR 412
ELISA kit for Mouse ANGPTL2 (Angiopoietin Like Protein 2)
E-EL-M0092 1 plate of 96 wells
EUR 534
  • Gentaur's ANGPTL2 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Mouse ANGPTL2. Standards or samples are added to the micro ELISA plate wells and combined w
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Mouse ANGPTL2 (Angiopoietin Like Protein 2) in samples from Serum, Plasma, Cell supernatant
ELISA kit for Mouse ANGPTL2 (Angiopoietin Like Protein 2)
ELK3189 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Angiopoietin Like Protein 2 (ANGPTL2). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific
  • Show more
Description: A sandwich ELISA kit for detection of Angiopoietin Like Protein 2 from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
CLIA kit for Mouse ANGPTL2 (Angiopoietin Like Protein 2)
E-CL-M0079 1 plate of 96 wells
EUR 584
  • Gentaur's ANGPTL2 CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse ANGPTL2 . Standards or samples are added to the micro CLIA plate wells and combined wit
  • Show more
Description: A sandwich CLIA kit for quantitative measurement of Mouse ANGPTL2 (Angiopoietin Like Protein 2) in samples from Serum, Plasma, Cell supernatant
Angiopoietin Like Protein 2 (ANGPTL2) Polyclonal Antibody (Mouse, Rat)
  • EUR 243.00
  • EUR 2457.00
  • EUR 613.00
  • EUR 305.00
  • EUR 212.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: ANGPTL2 (Ser267~His493)
  • Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse, Rat Angiopoietin Like Protein 2 (ANGPTL2)
Rabbit Angiopoietin Like Protein 2 ELISA kit
E04A0505-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rabbit Angiopoietin Like Protein 2 ELISA kit
E04A0505-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rabbit Angiopoietin Like Protein 2 ELISA kit
E04A0505-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Goat Angiopoietin Like Protein 2 ELISA kit
E06A0505-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Goat Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Goat Angiopoietin Like Protein 2 ELISA kit
E06A0505-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Goat Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Goat Angiopoietin Like Protein 2 ELISA kit
E06A0505-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Goat Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rat Angiopoietin Like Protein 2 ELISA kit
E02A0505-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rat Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rat Angiopoietin Like Protein 2 ELISA kit
E02A0505-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rat Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rat Angiopoietin Like Protein 2 ELISA kit
E02A0505-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rat Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Human Angiopoietin Like Protein 2 ELISA kit
E01A0505-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Human Angiopoietin Like Protein 2 ELISA kit
E01A0505-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Human Angiopoietin Like Protein 2 ELISA kit
E01A0505-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Dog Angiopoietin Like Protein 2 ELISA kit
E08A0505-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Canine Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Dog Angiopoietin Like Protein 2 ELISA kit
E08A0505-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Canine Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Dog Angiopoietin Like Protein 2 ELISA kit
E08A0505-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Canine Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Pig Angiopoietin Like Protein 2 ELISA kit
E07A0505-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Porcine Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Pig Angiopoietin Like Protein 2 ELISA kit
E07A0505-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Porcine Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Pig Angiopoietin Like Protein 2 ELISA kit
E07A0505-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Porcine Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Monkey Angiopoietin Like Protein 2 ELISA kit
E09A0505-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Monkey Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Monkey Angiopoietin Like Protein 2 ELISA kit
E09A0505-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Monkey Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Monkey Angiopoietin Like Protein 2 ELISA kit
E09A0505-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Monkey Angiopoietin Like Protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody (HRP)
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody (FITC)
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody (Biotin)
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody (HRP)
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody (FITC)
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody (Biotin)
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody (Biotin)
  • EUR 439.00
  • EUR 244.00
  • EUR 1261.00
  • EUR 606.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-12 working days.
Angiopoietin Like Protein 2 (ANGPTL2) Antibody (Biotin)
  • EUR 467.00
  • EUR 244.00
  • EUR 1344.00
  • EUR 634.00
  • EUR 356.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-15 working days.
Anti-Angiopoietin-like 4?/ANGPTL4 Antibody
A01147 100ug/vial
EUR 294